DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D10C

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001356427.1 Gene:TBC1D10C / 374403 HGNCID:24702 Length:454 Species:Homo sapiens


Alignment Length:367 Identity:151/367 - (41%)
Similarity:213/367 - (58%) Gaps:27/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQRTDKPKEPLSKAQII-AREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPK 85
            ||.||.||......|..|  .|.:| .||.||:.|..:|...||:.|||::.:||||||.::|.:
Human    38 DRYGFIGGSSAEPGPGHP--PADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRAR 100

  Fly    86 AWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLK 150
            .|..|.||::.:|.:|..|.||.|.||:|..:|.|.:|.|||||.||||:..|..||..|..|||
Human   101 CWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLK 165

  Fly   151 AYSIYNPKVGFCQAQAPIAAFLLMHLPAE--------DAFWVFVSVCDVYLQDYFIPGLEVIQND 207
            ||::|.|:.|:||||.|:||.||||||.|        :|||..|.:|:|||..|:.|.:|.::.|
Human   166 AYTLYRPEQGYCQAQGPVAAVLLMHLPPEACALPLPQEAFWCLVQICEVYLPGYYGPHMEAVRLD 230

  Fly   208 AGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKV 272
            |.:...||::..|.|::|||:..|.||||:.:||||...|:||:.|:|||||.||:||.||:|:|
Human   231 AEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRV 295

  Fly   273 ALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIE------- 330
            .|.::..:|...:.|..|.||.|||..||:.....::||..::.:..:.|...|.|.|       
Human   296 GLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQ 360

  Fly   331 --------HTRQKARRAKQKAQQEAES-SGSGNGHRRNMPTL 363
                    ..|.:.|.|..:|..||:. :|...|.:..:|.:
Human   361 LPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 86/170 (51%)
TBC1D10CNP_001356427.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 8/21 (38%)
TBC 89..302 CDD:214540 105/212 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..454 2/11 (18%)
Interaction with calcineurin 414..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2344
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 312 1.000 Inparanoid score I2584
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46720
OrthoDB 1 1.010 - - D309166at33208
OrthoFinder 1 1.000 - - FOG0001498
OrthoInspector 1 1.000 - - otm41204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.