DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG8155

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:342 Identity:76/342 - (22%)
Similarity:129/342 - (37%) Gaps:72/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GIPKSVRPKAWFYLSGAY----------------LLKKKNPNVYNELLE------KPGNPT---- 115
            ||..|:|...|.:|...|                .:::|:.. |..|.:      |.|:..    
  Fly   226 GIDPSLRRVVWKHLLNVYPGGANGLALDGHQRMEFMRRKSEQ-YCRLRDTWKAAVKRGSVAGELA 289

  Fly   116 -TIEEIKKD---KHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHL 176
             ....:|||   ..|..||:....|.|.:.  .|||:|..|::.:|.|.:||..:.||:.||:.:
  Fly   290 YVTSMVKKDVLRTDRLHPFYAGSDDNQNIA--ALFNILTTYALNHPSVSYCQGMSDIASPLLVTM 352

  Fly   177 PAE-DAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDW 240
            ..| .|:..|.::......::.:.|:.:.|..|.:.|. |....|..:.:|:..:.:.||:...|
  Fly   353 NDEAQAYICFCAIMSRMRGNFMLDGIAMTQKFAHLTEA-LSFYDPEFWEYLKSQQADDLLFCYRW 416

  Fly   241 FLCAMTRTLPWETLLRV----WD-----CFLAEGIRVIFKVALVIIGASLSRH------------ 284
            .|..:.|..|:|..||:    |.     |...:.:.:..|..:.|..||:...            
  Fly   417 LLLELKREFPFEDALRMLEVQWSSLRYRCDGEKELALFEKEFVPITDASVPNSASTFSSSYSATP 481

  Fly   285 --------KVR-----KTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKA 336
                    |.|     |.|....::.:...|.....|.....::|..|||..::|....|....|
  Fly   482 TSPSYLLTKPRESPYTKVCALRRQSSSASLSSLSSSVGTSHGLDNTKRLNHSLDDNMSRHATAAA 546

  Fly   337 RRAKQ---KAQQEAESS 350
            ||.::   |..|..:.|
  Fly   547 RRQRRTSAKVHQSLDES 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 43/180 (24%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 52/216 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.