DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and RN-tre

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:329 Identity:100/329 - (30%)
Similarity:157/329 - (47%) Gaps:43/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FQRTDK------PKEPLSK-AQII-------AREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPK 80
            :.||||      .:.|.:: ||.:       .|:|||:.|::.|.....|.:|::    .||||.
  Fly    46 YHRTDKYGFLHDSRLPSTRDAQEVHRNKIEMERDKKWMKMLNQWPPPQDKLHKRV----YKGIPD 106

  Fly    81 SVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGN-PTTIEEIKKDKHRQFPFHEMFLDEQKVGQIE 144
            .||..||..|.........|..||..:|:.... .|...:|..|.:|||..:..|.:...|.|..
  Fly   107 RVRMVAWNKLLDIQQSINNNAGVYLRMLQLARKYSTETRQIDADVNRQFRDNLAFRERYSVKQCS 171

  Fly   145 LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEV------ 203
            |||||.||||||.::|:||..|.:|..||::|..|:|||...::  :..|.|.:.||.:      
  Fly   172 LFNVLNAYSIYNSELGYCQGMACVAGVLLLYLHEEEAFWALNTL--ITDQKYGMHGLFIEGFPKL 234

  Fly   204 ---IQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEG 265
               |.:...|:..:::|    :::|..||.|:.|||...||.......:|:...|||||.|:.:|
  Fly   235 TRFIDHHDRIMSKIMRK----LHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLDG 295

  Fly   266 IRVIFKVALVIIGASLSRHKVR----KTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVED 326
            .|||..:|:.|    |..||..    |....:.|.|.| |..:.....::..|..:.|:..:::|
  Fly   296 DRVILSMAITI----LYLHKDELLRLKDMDAIIEYLQV-RLHKNFGYSDDDAIQALERVMKKLKD 355

  Fly   327 FQIE 330
            .:::
  Fly   356 LKLD 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 60/171 (35%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456606
Domainoid 1 1.000 94 1.000 Domainoid score I1957
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1545
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47405
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.