DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001106836.1 Gene:Tbc1d14 / 360956 RGDID:1309993 Length:714 Species:Rattus norvegicus


Alignment Length:379 Identity:92/379 - (24%)
Similarity:152/379 - (40%) Gaps:112/379 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KEPLSKAQIIAREKKWL-------------------YMIDNW-SIYMSKNYKKIRDRCRKGIPKS 81
            |..|.:||   |.||.|                   .::.|| :::.|   ||:||...:|||.|
  Rat   368 KRELKEAQ---RRKKQLEERCKVEESIGNAVLTWNNEILPNWETMWCS---KKVRDLWWQGIPPS 426

  Fly    82 VRPKAWFYLSGAYLLKKKNPNVYNELL-----------------------EKPG-----NPTTIE 118
            ||.|.|....|..|      |:.:||.                       |..|     ...::|
  Rat   427 VRGKVWSLAIGNEL------NITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLE 485

  Fly   119 EIKKDKHRQF----------PFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLL 173
            .||.|..|.|          |:|:|           |.::|.||:.|.|.||:.|..:.|||.|:
  Rat   486 LIKLDISRTFPNLCIFQQGGPYHDM-----------LHSILGAYTCYRPDVGYVQGMSFIAAVLI 539

  Fly   174 MHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGIL-------EGLLKKTCPPVYRHLQKHKV 231
            ::|...|||..|.::.:...|..|      .:.|.|::       |...::..|.::.|.:|:.:
  Rat   540 LNLDTADAFIAFSNLLNKPCQMAF------FRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNL 598

  Fly   232 EPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGA---SLSR----HKVRKT 289
            ...:|:.||.....:::||.:...|:||.|..:|...:|:.||.|:..   .|:|    |..:  
  Rat   599 TADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQ-- 661

  Fly   290 CTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDF-QIEHTRQKARRAKQK 342
                    .:.|.||:...::.|...:.:::..|.:.: |:....||..|..:|
  Rat   662 --------FLTRLPEDLPADDVFAAISTVQMQSRNKKWAQVLSALQKDSREMEK 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 48/179 (27%)
Tbc1d14NP_001106836.1 DUF4207 147..384 CDD:290615 8/18 (44%)
TBC 419..651 CDD:214540 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.