DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D26

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001375394.1 Gene:TBC1D26 / 353149 HGNCID:28745 Length:468 Species:Homo sapiens


Alignment Length:250 Identity:81/250 - (32%)
Similarity:116/250 - (46%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 REKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPG 112
            |..||..|:.:|:.|.|.  ||:..|..|.||.:||.:||..|.....:|.:||..|..:.||..
Human    74 RTNKWQKMLADWTKYRST--KKLSQRVYKVIPLAVRGRAWSLLLDIDRIKSQNPGKYKVMKEKGK 136

  Fly   113 NPTTIEE-IKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHL 176
            ..:.|.. |:.|.......|.||:....|.|.||.::|.|||.|||:||:.:..:.|.|.||:.|
Human   137 RSSRIIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYNPEVGYHRDLSRITAILLLCL 201

  Fly   177 PAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF 241
            |.|||||....:..|    ::.|....::......|.:|.|:.|.:.|||.|..           
Human   202 PEEDAFWALTQLLAV----FYSPNTAWLERLLSHQEQVLHKSFPKIMRHLGKEG----------- 251

  Fly   242 LC----AMTRTL-------PWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHK 285
            ||    .:||.|       .:...||:||.|:.||.||:    ..::.||...|:
Human   252 LCIEGSMLTRLLRCFLDGKSFGLTLRLWDVFILEGARVL----TAMVHASFKIHR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/174 (31%)
TBC1D26NP_001375394.1 TBC 98..306 CDD:214540 71/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.