DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D16

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:94/232 - (40%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GIPKSVRPKAWFYLSGAY----------LLKKKNPNVYNELLEKPGNPTTIEE-----------I 120
            |:.||:|...|.:|...|          :|.......|.|:..|.....:.|:           :
  Fly   388 GLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIHFWKTVQIVV 452

  Fly   121 KKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWV 184
            :||..|....:..|..:.......:.|:|..:::||..:.:.|..:.:.|.:|..:..| :.||.
  Fly   453 EKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWC 517

  Fly   185 FVSVCDVYLQDYFI--PGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVE-PLLYMTDWFLCAMT 246
            ||.:..   :.:|:  |....:.::...|..|::...|..|:||::|... .||:...|.|....
  Fly   518 FVGLMQ---RAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRWLLLCFK 579

  Fly   247 RTLPWETLLRVWDC----FLAEGIRVIFKVALVIIGA 279
            |......::|:|:.    :|.:...:...:|::.:.|
  Fly   580 REFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYA 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 35/181 (19%)
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 47/232 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.