DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d15-17

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster


Alignment Length:341 Identity:76/341 - (22%)
Similarity:139/341 - (40%) Gaps:66/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APRSLDTISLC--STVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWL-YMIDNWSIYMSK 65
            |...|:|::..  ..|::.|||       ||.:: ..||::.|       || :...:..|..|.
  Fly   313 ADSELETLNAQDEKIVNNLPDR-------QRVER-GHPLTETQ-------WLEFQTPDGRISDSA 362

  Fly    66 NYKKIRDRCRKGIPKSVRPKAWFYLSGAYL-----------LKKKNPNVYNELLEKPGNPTTIE- 118
            ..|::  ..|.|:.:|:||:.|.:|...||           .|:|:...||...:.....||.| 
  Fly   363 RIKEL--IFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEA 425

  Fly   119 ----------EIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLL 173
                      :|:||..|.....:.|..|.......|..:|..|.:||..:|:.|..:.:.|.:|
  Fly   426 NFCGYRERKCQIEKDVKRTDRSLQFFAGEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPIL 490

  Fly   174 -MHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGI------LEGLLKKTCPPVYRHLQKHKV 231
             :.:...|.||.||...::...::.|       :.||:      :..|::....|::.:::.|..
  Fly   491 EIQVNEVDTFWCFVGFMELVFTNFDI-------DQAGMKTQFAQIRRLIEFANAPLFNYMRSHDS 548

  Fly   232 EPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAE----GIRVIFKVAL------VIIGASLSRHKV 286
            :.:.:...|.|....|.|..|.:|::|:|....    ...::|.||:      |||.:.....::
  Fly   549 DNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQYEFTEI 613

  Fly   287 RKTCTGLCETLAVLRS 302
            .|....|...:.|.::
  Fly   614 LKHVNELSGNIDVQKT 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 41/190 (22%)
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 53/235 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.