DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG1695

DIOPT Version :10

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:96/235 - (40%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NPNVYN-ELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQ 163
            |..||: ||||:.|  ..:..|:||..|....:..|.:|   ...:|.||:..|...:..||:.|
  Fly   964 NGGVYSVELLEQFG--LNLHRIEKDVQRCDRNYWYFANE---NLDKLRNVISTYVWEHLDVGYMQ 1023

  Fly   164 AQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQ 227
            ....:.|.||:....|. ::..|..:.:..::::  |....:......:..|::.....:|..:.
  Fly  1024 GMCDLVAPLLVIFDDESLSYSCFCKLMERMIENF--PSGGAMDMHFANMRSLIQILDSEMYDLMD 1086

  Fly   228 KHKVEPLLYMT-DWFLCAMTRTLPWETLLRVWDCF-----LAEGIRVIF-KVAL------VIIGA 279
            .:......|.. .|||....|.|.::.:...|:..     :|.|..|:| .:||      :|:..
  Fly  1087 SNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSN 1151

  Fly   280 SLSRHKVRKTCTGLCE---TLAVLRSPEEHIVEEEFIINN 316
            |:....|.|....:.|   ..::|:.....:::.:.||.|
  Fly  1152 SMDFTDVIKFFNEMAERHNAQSILQLSRSLVLQLQTIIEN 1191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 TBC 74..278 CDD:214540 43/192 (22%)
CG1695NP_728346.2 RUN_SGSM1_like 39..233 CDD:439049
PH_RUTBC 310..485 CDD:275431
TBC 947..1124 CDD:214540 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.