DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d10aa

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_009302447.1 Gene:tbc1d10aa / 325772 ZFINID:ZDB-GENE-030131-4497 Length:896 Species:Danio rerio


Alignment Length:364 Identity:161/364 - (44%)
Similarity:232/364 - (63%) Gaps:18/364 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVSSCPDRNGFYGGFQR--TDKPKE-PLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKG 77
            |.|...|:.||.||.|:  |:..:: ||  |.:..||.|||.|:::|..::||.:||:|.||:||
Zfish    41 TSSRQTDKYGFIGGAQQYSTEMAQDVPL--AVLRHREAKWLDMLNHWDKWISKRFKKVRLRCQKG 103

  Fly    78 IPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQ 142
            ||.|:|.:||.||||..:.:::|..::.:|....|:|..|:.|::|.||||||||||:.....||
Zfish   104 IPPSLRGRAWLYLSGGKVKREQNVGMFKDLDSMEGDPKWIDVIERDLHRQFPFHEMFVSRGGHGQ 168

  Fly   143 IELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQND 207
            .:||.|||||::|.|..|:|||||||||.||||:|||||||..|.:|:.||..|:..|||.||.|
Zfish   169 QDLFRVLKAYTLYRPDEGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLD 233

  Fly   208 AGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKV 272
            ..||..|||:..||.|:||.|||:||:||||:||:||.:|||||.::|||||.||.:|:::||:|
Zfish   234 GLILNALLKRVSPPAYQHLDKHKIEPILYMTEWFMCAFSRTLPWSSVLRVWDMFLCDGVKIIFRV 298

  Fly   273 ALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKAR 337
            .||::...|...:..|.|.|..||:.:|::.|...::|.|:::.:|.:.:...|.:.||..|..|
Zfish   299 GLVLLKCMLGTREKLKACPGQYETMELLKALEPRYMQEAFLVHQVMEMPISARDVEREHRAQLKR 363

  Fly   338 RAKQKAQQEAESSGSGNGHR-------------RNMPTL 363
            ..|...:...:|....:|.:             |..||:
Zfish   364 WRKTHGELSYKSPPRMHGAQAIMSAEPHSRQDLRQKPTI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 98/162 (60%)
tbc1d10aaXP_009302447.1 RabGAP-TBC 142..305 CDD:278964 97/162 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2118
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 331 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309166at33208
OrthoFinder 1 1.000 - - FOG0001498
OrthoInspector 1 1.000 - - otm25978
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.