DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Evi5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_727526.2 Gene:Evi5 / 32088 FlyBaseID:FBgn0262740 Length:807 Species:Drosophila melanogaster


Alignment Length:326 Identity:92/326 - (28%)
Similarity:158/326 - (48%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SKAQIIARE---KKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPN 102
            |....:|.|   ..|..::::|...:.:....:.:..|:|||...|...|..||||....||.  
  Fly    77 SSGNSVAEEDIWTTWATILNDWEGALKRKNPCVSELVRRGIPHHFRAIVWQQLSGASDGDKKQ-- 139

  Fly   103 VYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAP 167
             |.|.::  ......:.|::|..|.:|..|.|.::...||..||||:||||:::.:||:||....
  Fly   140 -YAEYIK--ATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGF 201

  Fly   168 IAAFLLMHLPAEDAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGI----LEGLLKKTCPPVYRHLQ 227
            |...|||.:|.|:||.|.|.:...: ::..|.|.:    ::.|:    ||.|:::..|.::.|.|
  Fly   202 IVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSM----SELGLCMYQLENLVQEQIPDMHIHFQ 262

  Fly   228 KHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG 292
            :...:..:|.:.|||...|.||......|:.|.||:||:..||||||.::            .||
  Fly   263 QQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALL------------LTG 315

  Fly   293 ----LC-ETLAVLRSPEEHI-------VEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQQ 345
                || :..|:|:..::.:       ||..|.:...::||.:    :::...::.:..|:|.|:
  Fly   316 KDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTK----RMKKMEKEYQDLKKKEQE 376

  Fly   346 E 346
            |
  Fly   377 E 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 58/167 (35%)
Evi5NP_727526.2 TBC 113..320 CDD:214540 74/227 (33%)
DUF4527 627..>731 CDD:291689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.