DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster


Alignment Length:235 Identity:52/235 - (22%)
Similarity:96/235 - (40%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NPNVY-NELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQ 163
            |..|| :||||:.|  ..:..|:||..|....:..|.:|   ...:|.||:..|...:..||:.|
  Fly   927 NGGVYSSELLEQFG--LNLHRIEKDVQRCDRNYWYFANE---NLDKLRNVISTYVWEHLDVGYMQ 986

  Fly   164 AQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQ 227
            ....:.|.||:....|. ::..|..:.:..::::  |....:......:..|::.....:|..:.
  Fly   987 GMCDLVAPLLVIFDDESLSYSCFCKLMERMIENF--PSGGAMDMHFANMRSLIQILDSEMYDLMD 1049

  Fly   228 KHKVEPLLYMT-DWFLCAMTRTLPWETLLRVWDCF-----LAEGIRVIF-KVAL------VIIGA 279
            .:......|.. .|||....|.|.::.:...|:..     :|.|..|:| .:||      :|:..
  Fly  1050 SNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSN 1114

  Fly   280 SLSRHKVRKTCTGLCE---TLAVLRSPEEHIVEEEFIINN 316
            |:....|.|....:.|   ..:||:.....:::.:.||.|
  Fly  1115 SMDFTDVIKFFNEMAERHNAQSVLQLARSLVLQLQMIIEN 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 34/176 (19%)
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.