DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG4041

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:350 Identity:78/350 - (22%)
Similarity:136/350 - (38%) Gaps:64/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FQRTDKPKEP------LSKAQIIAREKKWLYMIDNWSIY--MSKNYKKIRDRCRK----GIPKSV 82
            |.....|:.|      |.:..::.|||...|......::  :.:.|....::.::    .:|..:
  Fly   372 FPLLHSPRFPAHFARELQELPLVIREKDIEYQFQRVRLFARLLQGYPHTAEQLQREAAVDVPPLL 436

  Fly    83 RPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFN 147
            |...|     |.||:.. ||.....::|..:.:|..:|:.|..|...:.|:.....  |..:|..
  Fly   437 RGPIW-----AALLEVV-PNGSYAKIDKFTSTSTDRQIEVDIPRCHQYDELLSSPD--GHRKLRR 493

  Fly   148 VLKAYSIYNPKVGFCQAQAPIAA-FLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLEVIQNDAGI 210
            :|||:...:|:..:.|....:.| ||.::...|: ||.........|||.:|:.     .|.|.|
  Fly   494 LLKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIPKYLQWFFLK-----DNSAVI 553

  Fly   211 LEGLLKKTC------PPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWD-CFLAEGIRV 268
            .|.|.|.:.      |.:.:||......|.|:...|||...:...|...:|.:|| ..|.:....
  Fly   554 KEYLSKFSQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDKLMLGDSSYP 618

  Fly   269 IFKVALVIIGASLSRHKVRKT--------CTGLCETL-------AVLRSPEEHIVEEEFIINNMM 318
            :|      ||.::.| ::|.|        |..|...|       .||.|.:.:....:.|.:...
  Fly   619 LF------IGIAILR-QLRSTLLTSGFNECILLFSDLPDIVMDGCVLESQKMYEATPKSITHRQH 676

  Fly   319 RLNLR--------VEDFQIEHTRQK 335
            .|.|:        |.|.:::|.:|:
  Fly   677 ALRLQPPQALDIGVADVELKHLQQE 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 42/171 (25%)
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 56/221 (25%)
RHOD_Kc 706..810 CDD:238783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.