DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d2

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006238118.1 Gene:Tbc1d2 / 313234 RGDID:1306860 Length:924 Species:Rattus norvegicus


Alignment Length:400 Identity:106/400 - (26%)
Similarity:168/400 - (42%) Gaps:70/400 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APRSLDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLS-KAQIIAREKKWLYMI----------D 57
            |..:.|::.| |.||...|    ||.....|...|.|. .|:|.|.|.:..:::          |
  Rat   541 AGEASDSVGL-SPVSEYDD----YGFLTVPDYEVEDLKLLAKIQALEVRSHHLLALEAVERPLRD 600

  Fly    58 NWS----IYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELL------EKPG 112
            .|:    :..|...|::   .|.|:|:..||:.|.:|....:....:...|.|||      |.| 
  Rat   601 RWATLTELMPSAELKQL---LRAGVPREHRPRVWRWLVHRRVQHLHSSGCYQELLARGRACEHP- 661

  Fly   113 NPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLP 177
               ...:|:.|.:|.||.::.|.........:|..||.|:|..||.:|:||....:||..|:.|.
  Rat   662 ---AARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLE 723

  Fly   178 AED-AFWVFVSVCDVYL-QDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDW 240
            .|: |||..|::.:..| .:|:...|...|.|..:|:.||.:..|.:..||.:..|:..|...:|
  Rat   724 DEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQRHVDLSLITFNW 788

  Fly   241 FLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVI----------IGASLSRHKVRKTCT-GLC 294
            ||.....:|..:.||||||.||.||.:|:|:.||.|          :..||..::..:..| .:|
  Rat   789 FLVIFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILRLQDSLEIYQYLRFFTKTIC 853

  Fly   295 ET------------------LAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQ 341
            ::                  |..||:.....:|.|     :..|.|...:: :|....:.|...:
  Rat   854 DSRKLTSIAFNDMNPFPMKQLRQLRAAHRERLEAE-----LRELELLKAEY-LERRASRGRAVPE 912

  Fly   342 KAQQEAESSG 351
            ....|.|..|
  Rat   913 GCVSEDEGEG 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/174 (33%)
Tbc1d2XP_006238118.1 PH_TBC1D2A 44..145 CDD:269966
PH 44..137 CDD:278594
TBC 621..833 CDD:214540 69/215 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.