DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG3703

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:131 Identity:34/131 - (25%)
Similarity:51/131 - (38%) Gaps:46/131 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IGASLSRHKVRKTCTGLCETLAVLRS--PEEHIVE----EEFIINNM-----------MRLNLRV 324
            :||..|...:.....||.:..:||..  ...|:|:    :||..|::           :|..|.|
  Fly   328 LGAHSSGESLHSKAHGLLDKASVLMQMFASTHLVKPRTHDEFQQNSLKKTHKGNHWGDLRAQLEV 392

  Fly   325 EDFQ--------IEHTRQK---ARRAKQKAQQEAESS----------GSGNGH-------RRNMP 361
             |.|        :...|:|   .:||.:|.||:|||:          .|.||.       ||.:|
  Fly   393 -DIQEVAALAATLSCDREKLANIKRALRKQQQQAESTEFSDTGNPVINSQNGALTLPPRCRRAVP 456

  Fly   362 T 362
            |
  Fly   457 T 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 34/131 (26%)
CG3703NP_569874.1 RUN 516..703 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.