DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d9

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006255308.1 Gene:Tbc1d9 / 304645 RGDID:1308221 Length:1262 Species:Rattus norvegicus


Alignment Length:303 Identity:97/303 - (32%)
Similarity:149/303 - (49%) Gaps:45/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STVSSCPDR--------------NG------------FYGGFQRTDKPKEPLSK-AQIIAREKKW 52
            |.|||.|.|              ||            .|    |...|:|...| |:...:|:.|
  Rat   427 SLVSSSPQRSTSSDADGERPFNLNGNSVPTATQTLMTMY----RRRSPEEFNPKLAKEFLKEQAW 487

  Fly    53 LYMIDNW--SIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPT 115
            ......:  .|.|.:. :|.|:...||||:.:|.:.|..||||...|..:|..|.:|:||.....
  Rat   488 KIHFAEYGQGICMYRT-EKTRELVLKGIPERMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKY 551

  Fly   116 TI--EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPA 178
            .:  |||::|.||..|.|..|.:|  :|...|..||.||:..||.:|:|||...:.:.||::...
  Rat   552 NLATEEIERDLHRSLPEHPAFQNE--MGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKE 614

  Fly   179 EDAFWVFVSVCDVYLQDYF---IPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDW 240
            |:|||:.|::|:..|.||:   :.|..|   |.|:.|.|.:...|.:|..:|...|...:.:: |
  Rat   615 EEAFWLLVALCERMLPDYYNTRVVGALV---DQGVFEELARDYVPQLYDCMQDLGVISTISLS-W 675

  Fly   241 FLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSR 283
            ||......:|:|:.:.|.|||..|||:|||::||.::.|::.:
  Rat   676 FLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 60/167 (36%)
Tbc1d9XP_006255308.1 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
TBC 510..720 CDD:214540 77/215 (36%)
EFh <891..921 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.