DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d25

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001100425.1 Gene:Tbc1d25 / 302552 RGDID:1559711 Length:688 Species:Rattus norvegicus


Alignment Length:246 Identity:60/246 - (24%)
Similarity:104/246 - (42%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KP-KEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRC-RKGIPKSVRPKAWFYLSGAY--- 94
            || |.|||.|:.      ..|:  |....:|:. :::|.|. ..|:..|:|...|.||...|   
  Rat   193 KPFKPPLSDAEF------HTYL--NHEGQLSRP-EELRLRIYHGGVEPSLRKVVWRYLLNVYPDG 248

  Fly    95 --------LLKKKNPNVYNELLEKPG---NPTTIEEIK----KDKHRQFPFHEMFLDEQKVGQIE 144
                    .:|:|: ..|.:|..:..   ||..:|.|:    ||..|....|..:...:....:.
  Rat   249 LTGRERMDYMKRKS-REYEQLKSEWAQRVNPEDLEFIRSTVLKDVLRTDRAHPYYAGPEDGPHLR 312

  Fly   145 -LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY--LQDYFIPGLEVIQN 206
             |.::|..|::.:|:|.:||..:.:|:.:|..:..|.  ..||..|.:.  |...|.|....:..
  Rat   313 ALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEG--HAFVCFCGIMKRLAANFHPDGRAMAT 375

  Fly   207 DAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRV 257
            ....|:.||:...|..|::||:...:.|.:...|.|..:.|...::..||:
  Rat   376 KFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAFDDALRM 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 36/151 (24%)
Tbc1d25NP_001100425.1 TBC 225..454 CDD:214540 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.