DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d30

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_038936067.1 Gene:Tbc1d30 / 299824 RGDID:1305255 Length:946 Species:Rattus norvegicus


Alignment Length:257 Identity:72/257 - (28%)
Similarity:105/257 - (40%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RCRKGIPKSVRPKAWFYLSGAYL------LKKKNPNVYNELLEKPGNPTTIEEIKKDKHR----- 126
            |...||||..|.|.|..|:..||      ..|.....:|| ...|.:.:...:|.||.||     
  Rat   271 RLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNE-RSNPDDDSMGIQIVKDLHRTGCSS 334

  Fly   127 ---QFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLL--MHLPAEDAFWVFV 186
               |         |.:..::.|..||.||:.:|..||:||....:||.:|  |.....||..:.:
  Rat   335 YCGQ---------EAEQDRVVLKRVLLAYARWNKNVGYCQGFNILAALILEVMEGNEGDALKIMI 390

  Fly   187 SVCDVYL-QDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHK----------VEPLL---YM 237
            .:.|..| :.||:..|..:..|..:...||:...|.:.:||...:          .||.|   :.
  Rat   391 YLIDKVLPESYFVNNLRALSVDMAVFRDLLRLKLPELSQHLDTLQRTSNKESGGGYEPPLTNVFT 455

  Fly   238 TDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVI---IGASLSRHKVRKTCTGLCET 296
            ..|||......||..|:|::||....||..:|.:|:|.|   :|..:.       |   |||
  Rat   456 MQWFLTLFATCLPNHTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIE-------C---CET 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 52/189 (28%)
Tbc1d30XP_038936067.1 TBC 273..494 CDD:214540 65/230 (28%)
DUF4682 663..791 CDD:406220
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.