DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Rabgap1l

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006496938.1 Gene:Rabgap1l / 29809 MGIID:1352507 Length:1051 Species:Mus musculus


Alignment Length:322 Identity:86/322 - (26%)
Similarity:146/322 - (45%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAY----LLKKKNPNVYNELLEKPG 112
            |..::..|...:....|.:....:.|:|:::|.:.|..|:|.:    :|.|     |..|:.|..
Mouse   513 WGELLGRWHNNLGGRPKGLFTLVKSGVPEALRAEVWQLLAGCHDNQEMLDK-----YRILITKDS 572

  Fly   113 NPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLP 177
            ...::  |.:|.||.||.|:.|.|....||..|:.:.||||:::..:|:||.|:.:||.||:|:|
Mouse   573 AQESV--ITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVFDEDIGYCQGQSFLAAVLLLHMP 635

  Fly   178 AEDAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF 241
            .|.||.|.|::...| |:|.:....|.:......||.|:::..|.:|.|.....:|..:|.:.||
Mouse   636 EEQAFCVLVTIMYGYKLRDLYRNNFEDLHCKFYQLEKLMQEQLPDLYSHFCDLNLEAHMYASQWF 700

  Fly   242 LCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASL--------------------SRHKV 286
            |...|...|...:..:.|..|.||:.:||.|||.::..|.                    .|::.
Mouse   701 LTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRA 765

  Fly   287 RKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKAR--RAKQKAQQE 346
            .:....|.|....::.|.:.:.:.|.....|....|:.||....:.|:..|  .|..:.:||
Mouse   766 EENARRLMEQACNIKVPTKKLKKYEKEYQAMRENQLQQEDPMDRYKRENRRLQEASMRLEQE 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/163 (35%)
Rabgap1lXP_006496938.1 PTB_Rab6GAP 129..257 CDD:269922
DUF3694 290..421 CDD:372133
RabGAP-TBC 541..744 CDD:366170 67/209 (32%)
Smc <814..>1019 CDD:224117 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.