DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d17

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001099728.1 Gene:Tbc1d17 / 292886 RGDID:1309686 Length:646 Species:Rattus norvegicus


Alignment Length:307 Identity:66/307 - (21%)
Similarity:118/307 - (38%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DNWSIYMS-----KNYKKIRDRC-RKGIPKSVRPKAWFYLSGAYL------------LKKKNPNV 103
            :.|:.::.     :|..:::.|. ..|:...:|.:||.:|.| ||            ::||....
  Rat   285 EEWNRHVGPEGRLQNVPELKSRIFSGGLSPGLRREAWKFLLG-YLSWESSAEEHKAHVRKKTDEY 348

  Fly   104 Y----------------NELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAY 152
            :                |.||.  |..:.||   :|..|....::.:...:..|...|.::|..|
  Rat   349 FRMKLQWKSVSAEQERRNSLLH--GYRSLIE---RDVSRTDRTNKFYEGPENPGLGLLNDILLTY 408

  Fly   153 SIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLK 216
            .:|:..:|:.|..:.:.:.:|..:..| ||||.|....:: :...|....|.::...|.|..||:
  Rat   409 CMYHFDLGYVQGMSDLLSPILFVVQNEVDAFWCFCGFMEL-VHGNFEESQETMKRQLGQLLLLLR 472

  Fly   217 KTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLA--EGIRVIFKVALVIIGA 279
            ....|:...|.......|.:...|.|....|..|:..:||:|:....  .|..:...||..|:  
  Rat   473 VLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAIL-- 535

  Fly   280 SLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVED 326
            .:.|..:..:..|..|.|       :||        |.:.:.|.|||
  Rat   536 DMERDTLMLSGFGSNEIL-------KHI--------NELTMKLSVED 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 37/165 (22%)
Tbc1d17NP_001099728.1 DUF3548 3..218 CDD:192931
TBC 308..543 CDD:214540 53/243 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.