DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Usp6nl

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006254294.1 Gene:Usp6nl / 291309 RGDID:1311786 Length:833 Species:Rattus norvegicus


Alignment Length:305 Identity:99/305 - (32%)
Similarity:146/305 - (47%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEK 110
            |.|..|||.|:..|..|  ||.:|...|..||||..:|.:.|..|.....:|::..::|::|..:
  Rat    88 IERTSKWLKMLKRWERY--KNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHR 150

  Fly   111 P-GNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLM 174
            . |....|.:|..|.:|.|..|.||.|...|.|..||:||.||||||.:||:||..:.|.|.|||
  Rat   151 ARGCSPDIRQIDLDVNRTFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLM 215

  Fly   175 HLPAEDAFWVFVSVCD---VYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLY 236
            ::..|||||..|.:..   ..:..:|:.|...:.......|.:|.|....:.:||...::....|
  Rat   216 YMNEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFY 280

  Fly   237 MTDWFL-CAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG-----LCE 295
            ...||. |.:.|| |:...||:||.::.||.|::..::..|:  .|.|..:.|....     |.|
  Rat   281 TMKWFFQCFLDRT-PFRLNLRIWDIYIFEGERILTAMSYTIL--KLHRKHLMKLSMEELVEFLQE 342

  Fly   296 TLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAK 340
            |||     ::...|::|:|          |..|:..|..|  |||
  Rat   343 TLA-----KDFFFEDDFVI----------EQLQVSMTELK--RAK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/166 (34%)
Usp6nlXP_006254294.1 TBC 114..329 CDD:214540 71/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.