DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Sgsm1

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_017453793.1 Gene:Sgsm1 / 288743 RGDID:1308178 Length:1096 Species:Rattus norvegicus


Alignment Length:149 Identity:32/149 - (21%)
Similarity:59/149 - (39%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 ELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDY---------FI 198
            :|.|::.:|...:.::|:.|....:.|.||:.|..|. ||..|..:.....|::         |.
  Rat   908 KLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFA 972

  Fly   199 PGLEVIQ-NDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFL 262
            ....:|| .|:.:.| |:.:...  |.|        ..:...|||....|.|.::.:..||:...
  Rat   973 NMRSLIQILDSELFE-LMHQNGD--YTH--------FYFCYRWFLLDFKRELVYDDVFSVWETIW 1026

  Fly   263 A----EGIRVIFKVALVII 277
            |    .....:..:||.::
  Rat  1027 AAKHVSSAHYVLFIALALV 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 32/147 (22%)
Sgsm1XP_017453793.1 RUN 44..186 CDD:397055
PH_RUTBC 257..428 CDD:275431
TBC <884..1053 CDD:214540 32/149 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.