DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and SPAC4G8.04

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_593064.1 Gene:SPAC4G8.04 / 2543572 PomBaseID:SPAC4G8.04 Length:772 Species:Schizosaccharomyces pombe


Alignment Length:342 Identity:92/342 - (26%)
Similarity:145/342 - (42%) Gaps:62/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LSKAQII------AREKKWLYMIDNWSIYMSKNYK------------------------------ 68
            |:|..|:      .|:|       |||::..:.||                              
pombe   438 LNKKDILLDMKESTRQK-------NWSLFFQRLYKKYKITDEDTIGLLGISSIGVKGRHGKKRWH 495

  Fly    69 KIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPG--NPTTIEEIKKDKHRQFPFH 131
            |.|:..:.|:|...:.|.|...||||.|  .:|..|.|||.:..  ...::.:|..|.:|... .
pombe   496 KFRELVKNGVPLCYKAKVWLECSGAYQL--HSPGYYEELLSRTDEVESASVAQIDMDINRTMA-K 557

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAF-LLMHLPAEDAFWVFVSVCD-VYLQ 194
            .:|...:..|..:|..:|.|||.:||.:|:||....|.|| ||::...||||::.:|:.: |...
pombe   558 NVFFGGKGPGIPKLRRILVAYSRHNPHIGYCQGMNVIGAFLLLLYASEEDAFYMLMSIIENVLPP 622

  Fly   195 DYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWD 259
            .||.|.|...:.|..:|:..:|::.|.:|.||:...|:.......|||...|.|||.....|::|
pombe   623 KYFTPDLMTSRADQLVLKSFVKESLPEIYSHLELLGVDLDAISFHWFLSVYTDTLPTNISFRIFD 687

  Fly   260 CFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVE-----EEFIINNMMR 319
            ....:|...:|:|||.|:       |..|.....|.:.:.:.|....:|:     :.||.....|
pombe   688 MLFCDGYVCLFRVALTIL-------KSLKQQILACNSSSAIYSFLSDLVQYSFQPDSFIKEAADR 745

  Fly   320 LNLRVEDFQIEHTRQKA 336
            .:..|.:..||..|..|
pombe   746 WSKLVTEKSIERKRNLA 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 52/164 (32%)
SPAC4G8.04NP_593064.1 COG5210 212..732 CDD:227535 84/310 (27%)
TBC 501..713 CDD:214540 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.