DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D28

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_016879905.1 Gene:TBC1D28 / 254272 HGNCID:26858 Length:350 Species:Homo sapiens


Alignment Length:134 Identity:44/134 - (32%)
Similarity:62/134 - (46%) Gaps:4/134 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 REKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPG 112
            |..||..|:.:|:.|.|.  ||:..|..|.||.:||.:|...|.....:|.:||..|..:.||..
Human   115 RTNKWQKMLADWTKYRST--KKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKYKVMKEKGK 177

  Fly   113 NPTTIEE-IKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNP-KVGFCQAQAPIAAFLLMH 175
            ..:.|.. |:.|.......|.||:....|.|.||.::|.|||.||| .:|..|.:......|...
Human   178 RSSRIIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYNPAALGLLQDRGQFLVLLKSP 242

  Fly   176 LPAE 179
            .|::
Human   243 GPSD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 21/68 (31%)
TBC1D28XP_016879905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.