DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and gyp51

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_594886.1 Gene:gyp51 / 2542680 PomBaseID:SPAC26F1.09 Length:1031 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:49/189 - (25%)
Similarity:83/189 - (43%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YNELLEKPGNPTTIEEIKKDKHRQFP---FHEMFLDEQKV--------GQIELFNVLKAYSIYNP 157
            |:.|..|  |..:.:.|:||..|.|.   ....|.:.|::        ....|..||::.:|..|
pombe   635 YSSLSIK--NCDSDKAIRKDLDRTFAPEILSHFFSNRQQLEPTDNIAESTANLHRVLRSLAIVLP 697

  Fly   158 KVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGILEGLLKKTCPP 221
            :||:.|..:.||..|||||||..||.:.|.:...| ||:.|...:..:.........|::...|.
pombe   698 QVGYTQGMSWIAGALLMHLPAPQAFALLVFLFKNYHLQNIFSSEMRGLSRVLHQFTRLVEDYMPS 762

  Fly   222 VYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGAS 280
            :..|.::..::...|.::|||.......|.|.:..::|.....|..::|...|.::..|
pombe   763 LAIHFKRQDIKTCSYASEWFLTLFAYKFPLEVVAHLYDILFLYGPGILFNFGLALLSHS 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 44/174 (25%)
gyp51NP_594886.1 COG5210 233..890 CDD:227535 49/189 (26%)
TBC 569..826 CDD:214540 49/189 (26%)
PspA 889..>1024 CDD:224755
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.