DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and gyp51

DIOPT Version :10

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_594886.1 Gene:gyp51 / 2542680 PomBaseID:SPAC26F1.09 Length:1031 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:49/189 - (25%)
Similarity:83/189 - (43%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YNELLEKPGNPTTIEEIKKDKHRQFP---FHEMFLDEQKV--------GQIELFNVLKAYSIYNP 157
            |:.|..|  |..:.:.|:||..|.|.   ....|.:.|::        ....|..||::.:|..|
pombe   635 YSSLSIK--NCDSDKAIRKDLDRTFAPEILSHFFSNRQQLEPTDNIAESTANLHRVLRSLAIVLP 697

  Fly   158 KVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGILEGLLKKTCPP 221
            :||:.|..:.||..|||||||..||.:.|.:...| ||:.|...:..:.........|::...|.
pombe   698 QVGYTQGMSWIAGALLMHLPAPQAFALLVFLFKNYHLQNIFSSEMRGLSRVLHQFTRLVEDYMPS 762

  Fly   222 VYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGAS 280
            :..|.::..::...|.::|||.......|.|.:..::|.....|..::|...|.::..|
pombe   763 LAIHFKRQDIKTCSYASEWFLTLFAYKFPLEVVAHLYDILFLYGPGILFNFGLALLSHS 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 TBC 74..278 CDD:214540 48/185 (26%)
gyp51NP_594886.1 COG5210 233..890 CDD:227535 49/189 (26%)
DR0291 888..>1010 CDD:441187
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.