DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d17

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001036120.1 Gene:Tbc1d17 / 233204 MGIID:2449973 Length:645 Species:Mus musculus


Alignment Length:307 Identity:67/307 - (21%)
Similarity:119/307 - (38%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DNWSIYMS-----KNYKKIRDRC-RKGIPKSVRPKAWFYLSGAYL------------LKKKNPNV 103
            :.|:.|:.     :|..::::|. ..|:...:|.:||.:|.| ||            ::||....
Mouse   284 EEWNRYVGPEGRLQNVPELKNRIFSGGLSPGLRREAWKFLLG-YLSWESSAEEHKAHVRKKTDEY 347

  Fly   104 Y----------------NELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAY 152
            :                |.||.  |..:.||   :|..|....::.:...:..|...|.::|..|
Mouse   348 FRMKLQWKSVSAEQERRNSLLH--GYRSLIE---RDVSRTDRTNKFYEGPENPGLSLLHDILLTY 407

  Fly   153 SIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLK 216
            .:|:..:|:.|..:.:.:.:|..:..| ||||.|....:: :...|....|.::...|.|..||:
Mouse   408 CMYHFDLGYVQGMSDLLSPILFVVQNEVDAFWCFCGFMEL-VHGNFEESQETMKRQLGQLLLLLR 471

  Fly   217 KTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLA--EGIRVIFKVALVIIGA 279
            ....|:...|.......|.:...|.|....|..|:..:||:|:....  .|..:...||..|:  
Mouse   472 VLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAIL-- 534

  Fly   280 SLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVED 326
            .:.|..:..:..|..|.|       :||        |.:.:.|.|||
Mouse   535 DMERDTLMLSGFGSNEIL-------KHI--------NELTMKLSVED 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 37/165 (22%)
Tbc1d17NP_001036120.1 DUF3548 3..217 CDD:192931
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..85
Required for interaction with OPTN. /evidence=ECO:0000250 217..309 4/24 (17%)
TBC 307..542 CDD:214540 53/243 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 596..645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.