DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D9

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_055945.2 Gene:TBC1D9 / 23158 HGNCID:21710 Length:1266 Species:Homo sapiens


Alignment Length:303 Identity:98/303 - (32%)
Similarity:150/303 - (49%) Gaps:45/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STVSSCPDR--------------NG------------FYGGFQRTDKPKEPLSK-AQIIAREKKW 52
            |.|||.|.|              ||            .|    |...|:|...| |:...:|:.|
Human   429 SLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMY----RRRSPEEFNPKLAKEFLKEQAW 489

  Fly    53 LYMIDNW--SIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPT 115
            ......:  .|.|.:. :|.|:...||||:|:|.:.|..||||...|..:|..|.:|:||.....
Human   490 KIHFAEYGQGICMYRT-EKTRELVLKGIPESMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKY 553

  Fly   116 TI--EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPA 178
            .:  |||::|.||..|.|..|.:|  :|...|..||.||:..||.:|:|||...:.:.||::...
Human   554 NLATEEIERDLHRSLPEHPAFQNE--MGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKE 616

  Fly   179 EDAFWVFVSVCDVYLQDYF---IPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDW 240
            |:|||:.|::|:..|.||:   :.|..|   |.|:.|.|.:...|.:|..:|...|...:.:: |
Human   617 EEAFWLLVALCERMLPDYYNTRVVGALV---DQGVFEELARDYVPQLYDCMQDLGVISTISLS-W 677

  Fly   241 FLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSR 283
            ||......:|:|:.:.|.|||..|||:|||::||.::.|::.:
Human   678 FLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 60/167 (36%)
TBC1D9NP_055945.2 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..456 8/26 (31%)
TBC 512..722 CDD:214540 78/215 (36%)
EFh <893..923 CDD:385324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1075..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1132..1164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.