DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Rabgap1

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001349885.1 Gene:Rabgap1 / 227800 MGIID:2385139 Length:1064 Species:Mus musculus


Alignment Length:376 Identity:99/376 - (26%)
Similarity:167/376 - (44%) Gaps:46/376 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIARE------KKWLYMIDNWSIYMSKNYKKI 70
            |..|.:.|.|:.:      :..|..:..||....:::|      :.|..::..|.:.:|...|::
Mouse   496 SQSSMIPSPPEDD------EEEDNDEPLLSGFGDVSKECAEKILETWGELLSKWHLNLSVRPKQL 554

  Fly    71 RDRCRKGIPKSVRPKAWFYLSGA----YLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFH 131
            ....|.|:|:::|.:.|..|:|.    :|::|     |..|:.|.....:  .|.:|.:|.||.|
Mouse   555 SSLVRSGVPEALRGEVWQLLAGCHNNDHLVEK-----YRILITKESPQDS--AITRDINRTFPAH 612

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC-DVYLQD 195
            :.|.|....||..|:.:.||||:|:.::|:||.|:.:||.||:|:|.|.||.|.|.:. |..|::
Mouse   613 DYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRE 677

  Fly   196 YFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDC 260
            .|....|.:......||.|:::..|.:|.|.....:|..:|.:.|||...|...|...:..:.|.
Mouse   678 LFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDL 742

  Fly   261 FLAEGIRVIFKVALVIIGASL--------------------SRHKVRKTCTGLCETLAVLRSPEE 305
            .|.|||.|||.|||.::..|.                    .|::..:....|.|.....:..::
Mouse   743 LLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKRLMELACNTKISQK 807

  Fly   306 HIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQQEAESSGSGNGH 356
            .:.:.|...:.|.....:.|| .||...::.||. |:|....|.......|
Mouse   808 KLKKFEKEYHTMREQQAQQED-PIERFERENRRL-QEANMRLEQENDDLAH 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 59/163 (36%)
Rabgap1NP_001349885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..101
PTB_Rab6GAP 140..268 CDD:269922
DUF3694 302..432 CDD:315198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..520 6/29 (21%)
TBC 558..767 CDD:214540 72/215 (33%)
ERM 789..1013 CDD:330563 14/70 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.