DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d12

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_666064.3 Gene:Tbc1d12 / 209478 MGIID:2384803 Length:698 Species:Mus musculus


Alignment Length:305 Identity:77/305 - (25%)
Similarity:132/305 - (43%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPKEPLSKAQIIAREKKWL-YMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKK 98
            |.:|.::.|.:|     |: .::.||.:..|.  :::|:...:|:|.|||.|.|....|..|  .
Mouse   371 KQEESIASAMVI-----WINEILPNWEVMRST--RRVRELWWQGLPPSVRGKVWSLAVGNEL--N 426

  Fly    99 KNPNVYNELLEK------------PGNPT----------TIEEIKKDKHRQFPFHEMFLDEQKVG 141
            ..|.:|...|.:            ..|.|          ::|.||.|..|.||...:|   ||.|
Mouse   427 ITPELYEIFLSRAKERWKSFSESSSENDTEGLSVADREASLELIKLDISRTFPSLYIF---QKGG 488

  Fly   142 QIE--LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQ-DYFIPGLEV 203
            ...  |.::|.||:.|.|.||:.|..:.|||.|:::|...|||..|.::.:...| .:|.....:
Mouse   489 PYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSM 553

  Fly   204 IQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRV 268
            :.......|...::....::.|.:.:.:.|.:|:.||.....:::||.:...||||.|..:|...
Mouse   554 MLKYFATFEVFFEENLSKLFLHFKSYNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEF 618

  Fly   269 IFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFI 313
            :|:                   ||    |.:||..|:.:::.:||
Mouse   619 LFR-------------------TG----LGILRLYEDILLQMDFI 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 47/175 (27%)
Tbc1d12NP_666064.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..236
COG5210 304..639 CDD:227535 75/302 (25%)
RabGAP-TBC 468..635 CDD:278964 52/192 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.