DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d16

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006532756.1 Gene:Tbc1d16 / 207592 MGIID:2652878 Length:782 Species:Mus musculus


Alignment Length:283 Identity:64/283 - (22%)
Similarity:110/283 - (38%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPKEPLSK---AQIIARE---KKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGA 93
            :||.|.|:   .:.:.|.   ..||..:::.. .:.:.||..:.....||..|:|.:.|.:|...
Mouse   393 RPKLPSSEIHPEESLYRRLDVSAWLNHLNDLG-QVEEEYKLRQAIFFGGIDVSIRGEVWPFLLHY 456

  Fly    94 Y----------LLKKKNPNVYNELLEKPGNPTTIEE---------------IKKDKHRQFPFHEM 133
            |          .|:.:....|..:.:|..:.|..|:               ::.|::.||     
Mouse   457 YSHESTSEEREALRSQKRKEYAAIQQKRLSMTPEEQRAFWRNVQFTVDKDVVRTDRNNQF----- 516

  Fly   134 FLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMH-LPAEDAFWVFVSVCDVYLQDYF 197
            |..|.......:..:|..|::|||.:|:.|..:.:.|.:|.. |...|.||.||.:..   ...|
Mouse   517 FRGEDNPNVESMRRILLNYAVYNPAIGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQ---NTIF 578

  Fly   198 I--PGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPL--LYMTDWFLCAMTRTLPWETLLRVW 258
            :  |..|.::.....|..||:.|....|:||.....:.|  |:...|.|....|..|....||:|
Mouse   579 VSSPRDEDMERQLLYLRELLRLTHQRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIW 643

  Fly   259 DC----FLAEGIRVIFKVALVII 277
            :.    :..:...:...||:|.|
Mouse   644 EACWAHYQTDYFHLFICVAIVAI 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 44/186 (24%)
Tbc1d16XP_006532756.1 TBC 439..667 CDD:214540 55/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.