DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-6

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001021909.1 Gene:tbc-6 / 182185 WormBaseID:WBGene00015410 Length:330 Species:Caenorhabditis elegans


Alignment Length:300 Identity:75/300 - (25%)
Similarity:132/300 - (44%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQRTDKPKEPLS-KAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRC------------------ 74
            ||.|...|:|... |.|..|....:|.::             :|.||                  
 Worm    24 GFLRPWSPQEESGCKKQYEAWYSSYLPIV-------------VRRRCRWEKENPRRNSHLLQRFV 75

  Fly    75 RKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNP-TTIEEIKKDKHRQFPFHEMFLDEQ 138
            |||||.:.|.:.|.         :..|:..:.:.::...| ..|::||.|..|.||.:: ||..:
 Worm    76 RKGIPHTFRKELWL---------RSCPSRADGVWQRHEVPDEVIKQIKLDLPRTFPDNK-FLKTE 130

  Fly   139 KVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLE 202
            ...: .|...|.|.:.:.|.||:||....:|..:|:.:..|. |..:.|.:.. ..|:|:...:.
 Worm   131 GTRK-TLGRALFAVAEHIPSVGYCQGLNFVAGVILLVVNDESRAIDLLVHLVS-QRQEYYGKNMI 193

  Fly   203 VIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIR 267
            .::.|..:|..||::.||.|...|:|..|...:.:..||:|....:||.||:||:|||.:.||..
 Worm   194 GLRRDMHVLHSLLREHCPRVVVTLEKLDVGLDMLVGKWFVCWFVESLPMETVLRLWDCLIYEGDE 258

  Fly   268 VIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHI 307
            .:|::|:.:..:::       .....||::..|.:..::|
 Worm   259 WLFRIAVALFRSNM-------IAISSCESIDQLMTEVQNI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 51/164 (31%)
tbc-6NP_001021909.1 RabGAP-TBC 99..272 CDD:278964 51/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.