DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-19

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_510336.3 Gene:tbc-19 / 181511 WormBaseID:WBGene00007849 Length:1333 Species:Caenorhabditis elegans


Alignment Length:348 Identity:94/348 - (27%)
Similarity:162/348 - (46%) Gaps:46/348 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKN-----YKKIRDRCRKGIPKSVR 83
            |.||....::             |.|.|:     ||..::.:|     ..:.:..||||||.|:|
 Worm   411 NHFYANRSKS-------------ASEHKY-----NWKRFLEENDFIDLTPETKIMCRKGIPNSLR 457

  Fly    84 PKAWFYLSGAYLLKKKNPNVYNELL------------EKPGNPTTIEEIKKDKHRQFPFHEMFLD 136
            ...|..|....:...|  |||.:..            ||..:....::|..|..|..|.:..|:.
 Worm   458 ATVWKILINQQVEDLK--NVYGKYYYRNLCNIQGGEDEKTYSDVHQKQINLDLLRTMPNNVHFMS 520

  Fly   137 EQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYL-QDYFIPG 200
            ....|..:|..||.|:.::|.::|:||....:||..|:.:..|||||..::|.:.|. :.||...
 Worm   521 ANSKGVTQLLQVLHAFCLHNSQIGYCQGMNFLAATALLFVGPEDAFWFLIAVTERYFDKTYFDSN 585

  Fly   201 LEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEG 265
            |...|.|..:|:|||:...|.:.:||:...::...:..:||:......:|:.||||:|||||.||
 Worm   586 LTGAQADQEVLKGLLEVQHPKIMKHLKSLDIDVASFTLNWFISLFFDAVPFNTLLRIWDCFLLEG 650

  Fly   266 IRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRL-----NLRVE 325
            .:|:|:.|:|:||........|....|:   :.|.::..:...:||.|:|...|:     .:.::
 Worm   651 PKVLFRFAIVLIGKHEEEIISRGDAIGI---MRVSKAATKLAFDEEAIVNMAFRIPNLPTRIELK 712

  Fly   326 DFQIEHTRQKARRAKQKAQQEAE 348
            :.|:::....|.|.::|.::..|
 Worm   713 NMQLQYVNLLAERLEKKMRRANE 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/163 (33%)
tbc-19NP_510336.3 PH-like 13..112 CDD:302622
PH 16..110 CDD:278594
TBC 448..670 CDD:214540 72/223 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.