DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-18

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_509421.2 Gene:tbc-18 / 181091 WormBaseID:WBGene00018281 Length:826 Species:Caenorhabditis elegans


Alignment Length:345 Identity:82/345 - (23%)
Similarity:135/345 - (39%) Gaps:45/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQRTDKPKEP---------------------------LSKAQIIAREKKWLYMIDN--WSIYMS 64
            ||::.|...:|                           :|..|.:.:|.|     |:  ||..:.
 Worm    75 GFRKQDDDHDPNLGDEEETSSAKHLSEPLENSTHKLKLISYLQDVHKEVK-----DDVLWSHILG 134

  Fly    65 KNYKKIRDRCRK-----GIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEK--PGNPTTIEEIKK 122
            ...|  .||..:     |||.|:||..|..||||...:|.....|..:|::  ...|:...:|::
 Worm   135 PELK--TDRFEELLKEGGIPHSMRPFLWPRLSGATKKQKDAKYTYESVLQQCAQDKPSIGVQIER 197

  Fly   123 DKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVS 187
            |..|..|.:..|..:...|...|..:||..:...|.:|:||....|.|.||::...|..||:..:
 Worm   198 DLLRTLPNNICFWKKNSEGIEALRRILKCVAFIYPDLGYCQGMGVIVATLLLYCSEETTFWMMTA 262

  Fly   188 VC-DVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPW 251
            :. |:...:::...|..:|.|..:...|:|...|.:.:.|:.::||..|....|.|.........
 Worm   263 LIEDILPPNFYTQTLLGLQADERVSRHLMKCHVPDLNKALEDYEVEVSLLTVSWLLTLFGSVFRT 327

  Fly   252 ETLLRVWDCFLAEGIRVIFKVALVIIGASLSR-HKVRKTCTGLCETLAVLRSPEEHIVEEEFIIN 315
            ..:|||||.....|...||:|.:.|:...... .::.:|.....:....|......:.|.|.:|.
 Worm   328 RVMLRVWDFIFYSGGVNIFRVIISILKMKEQEIVEIAETTQSSADIFTALSQLPASVTEVEKVIE 392

  Fly   316 NMMRLNLRVEDFQIEHTRQK 335
            .|......:.|..|...|:|
 Worm   393 YMGSFEFTITDHLIAELRKK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 43/163 (26%)
tbc-18NP_509421.2 TBC 148..361 CDD:214540 58/212 (27%)
SH3_SGSM3 528..580 CDD:212747
RUN 607..765 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.