DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-12

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_508458.1 Gene:tbc-12 / 180556 WormBaseID:WBGene00044061 Length:614 Species:Caenorhabditis elegans


Alignment Length:364 Identity:88/364 - (24%)
Similarity:150/364 - (41%) Gaps:68/364 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QRTDKPK------EPLSKAQIIAREKKWL-YMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWF 88
            ||.:|.:      :...:.|..|..:.|: .::..|.  ..|:.|:.|:...:|:|..||.:.||
 Worm   247 QRAEKERLQAKAEQKRLEEQTAAHCRVWVEQILPKWE--EMKDSKRCRELWWQGVPAKVRGELWF 309

  Fly    89 YLSGAY----------LLKKKNPNVYNELLEKPGN-----PTTIEEIKKDKHRQFPFHEMFLDEQ 138
            ...|..          |:.:....:..:|.|:..|     .|::.:|..|..|.|....||   |
 Worm   310 LTIGNQIEITKELYDGLMDQAEEKIAKQLAEQNKNSAERKETSVTQIHLDATRTFTSLGMF---Q 371

  Fly   139 KVGQI--ELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGL 201
            |.|..  .|..:|.||:|..|.:|:.|:...|||.||:.:....||..|.::.|..||..|. ||
 Worm   372 KDGPYYDHLLKLLSAYAILRPDIGYVQSMTFIAAVLLIQMDPYPAFISFANLLDRSLQSAFF-GL 435

  Fly   202 EVIQNDAGIL--EGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAE 264
            :..|.....:  :..|::..|.:::||.|..|.|.||:.:|......::||.:...|:||.:..:
 Worm   436 KQPQMTEYFIAYDRYLEQELPALHQHLDKLDVRPDLYLIEWTFAMYAKSLPLDVTCRIWDVYFRD 500

  Fly   265 GIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEF---------IINNMMRL 320
            |...:||.|                       |.:||..|..::..:|         :.|.:...
 Worm   501 GEEFLFKAA-----------------------LGILRMYEPKLLTMDFDDCVEFLTKLPNTLTGA 542

  Fly   321 NL--RVEDFQIEHTRQKARRAKQKAQ--QEAESSGSGNG 355
            .|  .:|.|...:..:.:|..|:.:|  ||.:...:..|
 Worm   543 ELFRNIEPFMRPYNGESSRSKKRFSQIFQEIDERVNPGG 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 52/166 (31%)
tbc-12NP_508458.1 TBC 295..521 CDD:214540 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.