DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-11

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_508178.2 Gene:tbc-11 / 180444 WormBaseID:WBGene00018075 Length:934 Species:Caenorhabditis elegans


Alignment Length:395 Identity:106/395 - (26%)
Similarity:169/395 - (42%) Gaps:64/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQRTDKPKEPLSKAQIIAREKK------WLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAW 87
            |...:|..:..||.:..:::|.|      |..:|:||. ..|...:||.:....|||..:|.:.|
 Worm   369 GDDESDCDEPLLSGSGKVSQECKEEHLEMWDQLIENWD-QQSDRPQKISELVLDGIPDKLRGRVW 432

  Fly    88 FYLSGAYLLKKKNPNV---YNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVL 149
            ..||...:|....|::   |:..|.:|.....:  |.:|.||.||.|:.|.:.|..||..|:.:.
 Worm   433 QLLSNVRILAIDQPDLVEKYHIFLSQPCPSEQV--IMRDIHRTFPAHDYFKESQGKGQQSLYKIS 495

  Fly   150 KAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGILEG 213
            |.||:|:.:|.:||..:.:||.||:|:|.|.||...|.:...| |:|.|..|.:.:......|..
 Worm   496 KVYSLYDEEVSYCQGLSFLAASLLLHMPEEQAFCTLVKIMFNYGLRDLFKLGFDNLHLRFFQLTA 560

  Fly   214 LLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIG 278
            |||...|.:..||:...:|..:|.:.|||...|...|.:.:..:.|.||::|:..||.::|.::.
 Worm   561 LLKDYIPDLSHHLEHIGIETHMYASQWFLTLFTAKFPLQMVFFILDLFLSQGMNTIFHISLALLD 625

  Fly   279 -------------------ASLSRHKVRKTCTGLC------------ETLAVLRSPEEHIVE--- 309
                               .||.| |.|...:..|            ..|.|..:..:.|.|   
 Worm   626 DAKTDLLQLDFEGTLKYFRVSLPR-KYRTEASTKCLIHKAVKFRLNHSKLEVYENEYKRIKELER 689

  Fly   310 --EEFIIN----------NMMRLNLRVEDFQIEHTRQK--ARRAKQKAQQEAESSGSGNGH--RR 358
              |:.::.          |.:||....:|...|....|  .||....|:.:.|:|.:....  |:
 Worm   690 ENEDPVLRMEKEIGRHQANTLRLERENDDLAHELVTSKIELRRKLDVAEDQIETSANAIERLTRQ 754

  Fly   359 NMPTL 363
            ||..|
 Worm   755 NMDIL 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 55/163 (34%)
tbc-11NP_508178.2 PH-like 11..147 CDD:388408
DUF3694 183..293 CDD:372133
TBC 419..632 CDD:214540 67/214 (31%)
Smc <697..>901 CDD:224117 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.