DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-8

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001255072.1 Gene:tbc-8 / 176454 WormBaseID:WBGene00008018 Length:913 Species:Caenorhabditis elegans


Alignment Length:284 Identity:55/284 - (19%)
Similarity:98/284 - (34%) Gaps:73/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KKIRDRCRKGI-PKSVRPKAWFYLSGAY-----------------------------LLKKKNPN 102
            |::..|..:|| .|.||..||.||.|.:                             .:::::..
 Worm   587 KRVYWRGIEGINTKEVRRMAWPYLLGLFEWNESPESRLEQFTSQYWQDIEEWRVLEAEVRRRDEE 651

  Fly   103 VYN----------------ELLEKPGNPT----------------TIEEIKKDKHRQFPFHEMFL 135
            .:.                ::.|.|..||                .:..|.||..| ...:.||.
 Worm   652 AFRAARARKAASPVREESCDVFEDPNEPTCSQHYDRENLITLFRANLHRIDKDVER-CDRNLMFF 715

  Fly   136 DEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYF--I 198
             ..|.....|..|:..|...|.:.|:.|....:.|.||:....|.......|:..:..:..|  .
 Worm   716 -SNKDNLESLRRVMYTYVRRNLEEGYTQGMCDLLAPLLVTFEDEALTLECFSLLMLRQRGKFPQR 779

  Fly   199 PGL-EVIQNDAGILEGLLKKTCPPVYRHLQK-HKVEPLLYMTDWFLCAMTRTLPWETLLRVWD-C 260
            ||: :.:.|    |..|::...|.:|..:.. ...:.|.:...|||....|.|.:|...:||: .
 Worm   780 PGMSKCLLN----LRSLIQVVDPQIYALISDIDYAQALSFAFRWFLLDFKRELSYECTYKVWEVI 840

  Fly   261 FLAEGIRVIFKVALVIIGASLSRH 284
            :.|:.:|:....|:....|:::.:
 Worm   841 WAAQRLRITDDFAIFFGLATITNY 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 40/183 (22%)
tbc-8NP_001255072.1 RUN 177..237 CDD:214736
PH_RUTBC 299..467 CDD:275431
TBC 670..869 CDD:214540 43/201 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.