Sequence 1: | NP_650089.1 | Gene: | wkd / 41390 | FlyBaseID: | FBgn0037917 | Length: | 363 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001255072.1 | Gene: | tbc-8 / 176454 | WormBaseID: | WBGene00008018 | Length: | 913 | Species: | Caenorhabditis elegans |
Alignment Length: | 284 | Identity: | 55/284 - (19%) |
---|---|---|---|
Similarity: | 98/284 - (34%) | Gaps: | 73/284 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 KKIRDRCRKGI-PKSVRPKAWFYLSGAY-----------------------------LLKKKNPN 102
Fly 103 VYN----------------ELLEKPGNPT----------------TIEEIKKDKHRQFPFHEMFL 135
Fly 136 DEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYF--I 198
Fly 199 PGL-EVIQNDAGILEGLLKKTCPPVYRHLQK-HKVEPLLYMTDWFLCAMTRTLPWETLLRVWD-C 260
Fly 261 FLAEGIRVIFKVALVIIGASLSRH 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wkd | NP_650089.1 | RabGAP-TBC | 114..277 | CDD:366170 | 40/183 (22%) |
tbc-8 | NP_001255072.1 | RUN | 177..237 | CDD:214736 | |
PH_RUTBC | 299..467 | CDD:275431 | |||
TBC | 670..869 | CDD:214540 | 43/201 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |