DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001317776.1 Gene:tbc-14 / 174986 WormBaseID:WBGene00008444 Length:630 Species:Caenorhabditis elegans


Alignment Length:389 Identity:76/389 - (19%)
Similarity:144/389 - (37%) Gaps:79/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQRTDKPKEPLSKAQIIAREKKW-LYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPK 85
            |..|.:....:.:.|..|....::...:..| .:.:.|.|....|.:....:..|.|:...:|.:
 Worm   267 DAAGEFEVVTQLELPPRPEIYRELPVSKDLWNSFKLSNGSYDPMKLHHLKMNVFRGGLNAELRKE 331

  Fly    86 AWFYLSG---------------AYLLKKKNPNVYNELLEKPGNPTTIEE------------IKKD 123
            ||..|.|               |.|.|:     |..:.::..:.|..:|            ::||
 Worm   332 AWKCLLGYRQWHESDTDFQTRRAELAKQ-----YENMKKQWMSVTEDQEKRFTKFVKRKSLVEKD 391

  Fly   124 ---KHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWV 184
               ..|..||   |..:..|..:.|.|||..|.:||..:|:.|..:..|:.||..:..| |.||.
 Worm   392 VARTDRTVPF---FQGDDNVNLVHLHNVLMTYVMYNFDLGYVQGMSDFASPLLFVMKDEVDTFWC 453

  Fly   185 FVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTL 249
            ||.:.:: .|..|......|:.....|..|:....|.:..:|:..|.:.:.:...|.|....|..
 Worm   454 FVGLMEL-TQKNFETDQAFIKLQMNQLRDLVMIINPKLANYLESEKSDDMYFCFRWVLVWFKREF 517

  Fly   250 PWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFII 314
            .:....::|:...:              |....|..:.     :|  :|:|.|....|::.:|.:
 Worm   518 SFLDTCKLWEVLWS--------------GQPCPRFLLL-----IC--VAILDSQTNIIIDNQFGL 561

  Fly   315 NNMMR------LNLRVEDF---------QIEHTRQK--ARRAKQKAQQEAESSGSGNGHRRNMP 361
            ..:::      ::|:|::.         |:..::.|  |...:.....|:..|.|.|...::.|
 Worm   562 TEILKHINDLSMHLKVDEILTAAEAIFHQLSASQNKLPAHICQYLNIGESAVSSSNNSPSKSDP 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 39/178 (22%)
tbc-14NP_001317776.1 DUF3548 51..197 CDD:371881
TBC 320..555 CDD:214540 56/264 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.