DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc-2

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_495156.1 Gene:tbc-2 / 173986 WormBaseID:WBGene00022880 Length:908 Species:Caenorhabditis elegans


Alignment Length:328 Identity:84/328 - (25%)
Similarity:145/328 - (44%) Gaps:50/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFY--GGFQRTD----------KPKEPLSKAQIIAREKKWLYMIDNWSIYMSKN-------- 66
            |:.|||  ..|..:|          |....:.:|..:.:.::::..:.:|..::..|        
 Worm   553 DQLGFYKKDDFSESDDLLDTATFYMKKAGDVVEATKLEQSEEYMKWLQSWDAFLVNNTVSRQTAI 617

  Fly    67 --YKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNV----YNELLEKPGN-------PTTIE 118
              ...::...|.|:|.:.|.:.|..:. .:.:|.|...:    |..:|.|.|.       ...|:
 Worm   618 MSSPDLKTLIRTGVPPAYRGRVWKIIV-THWVKDKQAELGNGYYQSMLRKAGTKKQDGSYDAAIK 681

  Fly   119 EIKKDKHRQFPFHEMFLDEQKVGQIE-LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAF 182
            :|..|..|..|.:::| ||.....|| |.|||.|:..:|..||:||....:||..|::|..:|:|
 Worm   682 QIDLDLARTLPTNKLF-DEPDSANIEKLRNVLYAFRYHNSHVGYCQGLNRLAAIALLNLDEQDSF 745

  Fly   183 WVFVSVCDVYLQ--DYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAM 245
            | |:..|..:||  .|:...|.....|..:|..|:.:..|.:..||:..:|:..|:...|||...
 Worm   746 W-FLVACVEHLQPEGYYTSSLIGAVADQKVLRDLVAEKLPKLAAHLRALEVDLSLFALSWFLTCF 809

  Fly   246 TRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAV----LRSPEEH 306
            ...||....|.::|.||.||.:|:|:.||.:.       |:.:.....|:|:..    |...:||
 Worm   810 VDVLPHSIYLTIFDAFLYEGNKVLFRFALALF-------KICEPHVLQCKTIGTVHQCLSKAQEH 867

  Fly   307 IVE 309
            |::
 Worm   868 IID 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 56/165 (34%)
tbc-2NP_495156.1 PH_TBC1D2A 20..119 CDD:269966
PH 20..111 CDD:278594
ATG16 235..400 CDD:285778
DUF1664 <289..368 CDD:285172
TBC 627..849 CDD:214540 68/231 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.