DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D21

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006720472.1 Gene:TBC1D21 / 161514 HGNCID:28536 Length:399 Species:Homo sapiens


Alignment Length:328 Identity:61/328 - (18%)
Similarity:111/328 - (33%) Gaps:97/328 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRD-RC----RKGIPKSVRPKAWFYLSGAY 94
            |.|.|:.|.:       |....|.     |.:..|.|| .|    .:|:...||.:||.:|:|.:
Human    22 KRKPPIDKTE-------WDSFFDE-----SGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYF 74

  Fly    95 -------------LLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQF------------------ 128
                         .:::||.....::.||      |:.:.::.||.|                  
Human    75 SWQSSQDERLTVDSMRRKNYKALCQMYEK------IQPLLENLHRNFTETRNNIARDIQKIYDKD 133

  Fly   129 PFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAP--------IAAFLLMHLPAEDAFWVF 185
            |...:.:|::::.:|.|.:.:            |..||.        :..|.||.....:.||:|
Human   134 PLGNVLIDKKRLEKILLLSYV------------CNTQAEYQQGFHEMMMLFQLMVEHDHETFWLF 186

  Fly   186 VSVCDVYLQDYFIPGLE-------VIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF-L 242
                     .:|:...|       .:..:..:|..|:....|....||:......:..:..|| .
Human   187 ---------QFFLQKTEHSCVINIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLFPWFCF 242

  Fly   243 CAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG------LCETLAVLR 301
            |.......::.:.|:|:..|.......|:|.:......:.|.:|.:...|      .|..|..|.
Human   243 CFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNLIDLD 307

  Fly   302 SPE 304
            :.|
Human   308 ADE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 32/196 (16%)
TBC1D21XP_006720472.1 TBC 62..287 CDD:214540 43/251 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.