DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D16

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_024306344.1 Gene:TBC1D16 / 125058 HGNCID:28356 Length:824 Species:Homo sapiens


Alignment Length:357 Identity:72/357 - (20%)
Similarity:124/357 - (34%) Gaps:115/357 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYM---IDNWSIYMS------KNYKKIRDRCRK 76
            ||:.......:|   ||.|.|:    ...::.:|.   :..|..:::      :.||..:.....
Human   367 PDKTCMQFSIRR---PKLPSSE----THPEESMYKRLGVSAWLNHLNELGQVEEEYKLRKAIFFG 424

  Fly    77 GIPKSVRPKAWFYLSGAY-------------LLKKKNPNVYNELLEKPGNPT------------- 115
            ||..|:|.:.|.:|...|             |.|:|.   |:|:.:|..:.|             
Human   425 GIDVSIRGEVWPFLLRYYSHESTSEEREALRLQKRKE---YSEIQQKRLSMTPEEHRAFWRNVQF 486

  Fly   116 TIEE--IKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMH-LP 177
            |:::  ::.|::.||     |..|.......:..:|..|::|||.||:.|..:.:.|.:|.. |.
Human   487 TVDKDVVRTDRNNQF-----FRGEDNPNVESMRRILLNYAVYNPAVGYSQGMSDLVAPILAEVLD 546

  Fly   178 AEDAFWVFVSV--------------CDVYLQDY-------------FIPG--------------- 200
            ..|.||.||.:              .:..|:::             .:||               
Human   547 ESDTFWCFVGLMQNTIFVSSPRDEDMEKQLEEWTWETAPKCALRVGSLPGHGAAASVLPRPGTTL 611

  Fly   201 -LEVIQNDAG-------------ILEGLLKKTCPPVYRHLQKHKVEPL--LYMTDWFLCAMTRTL 249
             |.:....|.             .|..||:.|....|:||.....:.|  |:...|.|....|..
Human   612 CLTLDHTTASGTVRSGRNWQRQLYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREF 676

  Fly   250 PWETLLRVWDC----FLAEGIRVIFKVALVII 277
            |....||:|:.    :..:...:...||:|.|
Human   677 PEAEALRIWEACWAHYQTDYFHLFICVAIVAI 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 47/240 (20%)
TBC1D16XP_024306344.1 TBC 424..709 CDD:214540 61/293 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.