DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d10c

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_848765.2 Gene:Tbc1d10c / 108995 MGIID:1922072 Length:444 Species:Mus musculus


Alignment Length:322 Identity:145/322 - (45%)
Similarity:200/322 - (62%) Gaps:7/322 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQ---RTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVR 83
            ||.||.||..   |..:|...|    |..||.||:.|..:|...||:.|||::.:||||||.::|
Mouse    36 DRYGFIGGNSGELRLCQPSADL----IRQREMKWVEMTLHWEKTMSRRYKKVKIQCRKGIPSALR 96

  Fly    84 PKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNV 148
            .:.|..|.||.:.:|.||..|.||...||:|..:|.|.:|.|||||.||||:..|..||..|..|
Mouse    97 ARCWPLLCGARMCQKNNPGTYQELAAAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQV 161

  Fly   149 LKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEG 213
            ||||::|.|:.|:||||.|:||.||||||.|:|||..|.:|:|||..|:.|.:|.:|.||.:...
Mouse   162 LKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVQLDAEVFMA 226

  Fly   214 LLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIG 278
            ||::..|.||:|||:..|.||||:.:||||..||:||:.|:||:||.||:||.:|:|:|.|.::.
Mouse   227 LLRRQLPRVYKHLQQVGVGPLLYLPEWFLCLFTRSLPFPTVLRIWDAFLSEGAKVLFRVGLTLMR 291

  Fly   279 ASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAK 340
            .:|...:.|..|.||.|||..||:.....::||..::.:..:.|.....|.|...|.|:.:|
Mouse   292 LALGTVEQRTACPGLLETLGALRAIPPTQLQEEVFMSQVHSVTLSERVLQQEIRIQLAQLSK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 87/162 (54%)
Tbc1d10cNP_848765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
TBC 87..292 CDD:214540 106/204 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..444
Interaction with calcineurin. /evidence=ECO:0000250 404..444
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2331
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2548
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46720
OrthoDB 1 1.010 - - D309166at33208
OrthoFinder 1 1.000 - - FOG0001498
OrthoInspector 1 1.000 - - otm43269
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.