DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Sgsm3

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006520307.1 Gene:Sgsm3 / 105835 MGIID:1916329 Length:761 Species:Mus musculus


Alignment Length:361 Identity:101/361 - (27%)
Similarity:157/361 - (43%) Gaps:74/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CPDRNGFY---------GGFQRTDKP--KEPLSKAQIIAR----------EKKWLYMIDNWSIYM 63
            |.|..||.         |..|.|..|  ::|..:.:..|.          :..|    |..::.:
Mouse    52 CYDEFGFRVDKEEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHDVGDLTW----DKIAVSL 112

  Fly    64 SKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNV-YNELLEKPGNPTTI--EEIKKDKH 125
            .:: :|:|.....|||..:||:.|..|||| |.||||..: |.|:::...|..||  ::|:||..
Mouse   113 PRS-EKLRSLVLAGIPHGMRPQLWMRLSGA-LQKKKNSELSYREIIKNSSNDETIAAKQIEKDLL 175

  Fly   126 RQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC- 189
            |..|.:..|.:...:|...|..||:|.:...|::|:||....:||.||:.|..|||||:..::. 
Mouse   176 RTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIE 240

  Fly   190 DVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETL 254
            |:....||...|..:|.|..:|..|:.:..|.:.:.||:|.:|..|....|||.|....:....|
Mouse   241 DLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLL 305

  Fly   255 LRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEE--------- 310
            ||:||.|..||..|:|:.                       ||.:||..||.:::.         
Mouse   306 LRIWDLFFYEGSLVLFQT-----------------------TLGMLRLKEEELIQSENSASIFNT 347

  Fly   311 -----------EFIINNMMRLNLRVEDFQIEHTRQK 335
                       |.::...|||...:.|..:|..|:|
Mouse   348 LSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 55/165 (33%)
Sgsm3XP_006520307.1 TBC 125..336 CDD:214540 79/234 (34%)
SH3_SGSM3 495..547 CDD:212747
RUN 574..725 CDD:367169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.