DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D3I

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006722286.1 Gene:TBC1D3I / 102724862 HGNCID:32709 Length:610 Species:Homo sapiens


Alignment Length:383 Identity:103/383 - (26%)
Similarity:160/383 - (41%) Gaps:76/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TAPRSLDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQI------IAREKKWLYMIDNWSI 61
            :|||.....:.||: |:.|       |...::....||:..:.      |:|:.||:.|:.:|..
Human    92 SAPRLGPLQAPCSS-SALP-------GLPYSETELPPLTAREAKQIRREISRKSKWVDMLGDWEK 148

  Fly    62 YMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTT--IEEIKKDK 124
            |  |:.:|:.||..||:|.::|...|..|.....:|.|||..| :::::.|..::  |:.|.:|.
Human   149 Y--KSSRKLIDRAYKGMPMNIRGPMWSVLLNTEEMKMKNPGRY-QIMKEKGKRSSEHIQRIDRDV 210

  Fly   125 HRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC 189
            ......|..|.|.....|.||.::|.||..|||:||:|:..:.|||..|::||.|||||..|.:.
Human   211 SGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLL 275

  Fly   190 DV---YLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKH----KVEPL----LYMTDWFLC 243
            ..   .||.:..|....:|......|.::..:.|....|..|.    :..||    ..:.|....
Human   276 ASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISL 340

  Fly   244 AMTRTLPWETLLRVWDCFLAEG-------IRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLR 301
            .:|        ||:||.:|.||       .|:.|||           .:.|.|.|..|...|   
Human   341 GLT--------LRLWDVYLVEGEQALMPITRIAFKV-----------QQKRLTKTSRCGPWA--- 383

  Fly   302 SPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQK-------AQQEAESSGS 352
                      ...|..:....|.||..::|.|...::..:|       |:.|..||.|
Human   384 ----------RFCNRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSAS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 53/182 (29%)
TBC1D3IXP_006722286.1 TBC 160..373 CDD:214540 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.