DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001106833.1 Gene:Tbc1d14 / 100855 MGIID:1098708 Length:714 Species:Mus musculus


Alignment Length:342 Identity:85/342 - (24%)
Similarity:143/342 - (41%) Gaps:90/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MIDNW-SIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELL---------- 108
            ::.|| :::.|   ||:||...:|||.|||.|.|....|..|      |:.:||.          
Mouse   402 ILPNWETMWCS---KKVRDLWWQGIPPSVRGKVWSLAIGNEL------NITHELFDICLARAKER 457

  Fly   109 -------------EKPG-----NPTTIEEIKKDKHRQF----------PFHEMFLDEQKVGQIEL 145
                         |..|     ...::|.||.|..|.|          |:|:|           |
Mouse   458 WRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIFQQGGPYHDM-----------L 511

  Fly   146 FNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGI 210
            .::|.||:.|.|.||:.|..:.|||.|:::|...|||..|.::.:...|..|      .:.|.|:
Mouse   512 HSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAF------FRVDHGL 570

  Fly   211 L-------EGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRV 268
            :       |...::..|.::.|.:|:.:...:|:.||.....:::||.:...|:||.|..:|...
Mouse   571 MLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEF 635

  Fly   269 IFKVALVIIGA---SLSR----HKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVED 326
            :|:.||.|:..   .|:|    |..:          .:.|.||:...:|.|...:.:::..|.:.
Mouse   636 LFRTALGILKLFEDILTRMDFIHSAQ----------FLTRLPEDLPADEVFAAISTVQMQSRNKK 690

  Fly   327 F-QIEHTRQKARRAKQK 342
            : |:....||..|..:|
Mouse   691 WAQVLSALQKDSREMEK 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 48/179 (27%)
Tbc1d14NP_001106833.1 ARGLU <350..>392 CDD:373772
TBC 419..651 CDD:214540 64/254 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.