DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_004911305.1 Gene:tbc1d14 / 100489752 XenbaseID:XB-GENE-991334 Length:794 Species:Xenopus tropicalis


Alignment Length:268 Identity:67/268 - (25%)
Similarity:111/268 - (41%) Gaps:70/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNEL------------ 107
            ::.||......  :::||...:|||.|||.:.|....|..|      |:.::|            
 Frog   482 ILPNWETMCCS--RRVRDMWWQGIPPSVRGRVWSLAIGNEL------NITHDLYDICLSRAKDRW 538

  Fly   108 ----------------LEKPGNPTTIEEIKKDKHRQF----------PFHEMFLDEQKVGQIELF 146
                            |.......::|.||.|..|.|          |:|:|           |.
 Frog   539 KSLSMGTQEADNEDSGLSVADREASLESIKLDISRTFPNLCIFQRGGPYHDM-----------LH 592

  Fly   147 NVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGIL 211
            ::|.||:.|.|.||:.|..:.|||.|:::|...|||..|.::.:...|..|      .:.|.|::
 Frog   593 SILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAF------FRVDHGLM 651

  Fly   212 -------EGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVI 269
                   |...::..|.::.|.:|:.:.|.:|:.||.....:::||.:...||||.|..:|...:
 Frog   652 LTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFL 716

  Fly   270 FKVALVII 277
            |..||.|:
 Frog   717 FSTALGIL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 50/179 (28%)
tbc1d14XP_004911305.1 TBC 499..731 CDD:214540 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.