DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d12b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005169505.1 Gene:tbc1d12b / 100332088 ZFINID:ZDB-GENE-121214-108 Length:771 Species:Danio rerio


Alignment Length:308 Identity:77/308 - (25%)
Similarity:131/308 - (42%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPKEPLSKAQIIAREKKW-LYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKK 98
            |.:|.::.|.::     | ..::.||.  ..:..:::||...:|:|.:||.|.|....|..|   
Zfish   445 KQEESIANAMVV-----WNTEILPNWE--SMRGTRRVRDLWWQGLPPNVRGKVWSLAVGNEL--- 499

  Fly    99 KNPNVYNELLE-------------------------KPGNPTTIEEIKKDKHRQFPFHEMFLDEQ 138
               |:.::|.|                         .....::::.||.|..|.||...:|   |
Zfish   500 ---NITSDLYEIFLSRAKERWKSFRETGSEIESDVDSADRESSLDLIKLDISRTFPSLFIF---Q 558

  Fly   139 KVGQIE--LFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQ-DYFIPG 200
            |.|...  |.:||.||:.|.|.||:.|..:.|||.|:::|...|||..|.::.:...| .:|...
Zfish   559 KGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVD 623

  Fly   201 LEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEG 265
            .|::.......|...::..|.::.|.:.:.:.|.||:.||......::||.:...||||.|..:|
Zfish   624 HELMLKYFAAFEVFFEENLPRLFNHFKSYNLTPDLYLIDWIFTLYAKSLPLDVACRVWDVFCRDG 688

  Fly   266 IRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFI 313
            ...:|:                   ||    |.:||..||.:::.:||
Zfish   689 EEFLFR-------------------TG----LGILRLYEELLLQMDFI 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 49/165 (30%)
tbc1d12bXP_005169505.1 TPX2 407..>451 CDD:284337 2/5 (40%)
TBC 478..708 CDD:214540 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.