DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and sgsm3

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001123837.1 Gene:sgsm3 / 100170594 XenbaseID:XB-GENE-965522 Length:753 Species:Xenopus tropicalis


Alignment Length:267 Identity:79/267 - (29%)
Similarity:128/267 - (47%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTI--EEIKKDKHRQFPFH 131
            |:|.....|||.|:||:.|..||||...|:.:...|.:::....|..|:  ::|:||..|..|.:
 Frog   107 KLRSLVLAGIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSN 171

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC-DVYLQD 195
            ..|.:.|.||...|..||:..:...|.:|:||....:||.||:.|..|||||:..::. |:....
 Frog   172 ACFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFLEEEDAFWMMAAIVEDLVPVS 236

  Fly   196 YFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDC 260
            ||...|..:|.|..:|..|:.:..|.:.:.||:|.:|..|....|||.|....:..:.|||:||.
 Frog   237 YFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDF 301

  Fly   261 FLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEE---FIINNMMRLNL 322
            |..:|..|:|:.                       ||.:|:..||.:::.|   .|.|.:..:..
 Frog   302 FFYQGSLVLFQT-----------------------TLGMLKMKEEELIQSENSASIFNTLSDIPS 343

  Fly   323 RVEDFQI 329
            ::|:..:
 Frog   344 QIEEADV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/165 (33%)
sgsm3NP_001123837.1 TBC 115..326 CDD:214540 73/233 (31%)
SH3_SGSM3 486..538 CDD:212747
RUN 565..716 CDD:367169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.