DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and usp6nl

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_031754908.1 Gene:usp6nl / 100135167 XenbaseID:XB-GENE-998647 Length:844 Species:Xenopus tropicalis


Alignment Length:331 Identity:101/331 - (30%)
Similarity:163/331 - (49%) Gaps:35/331 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQRTDKP--KEPLSKAQI--IAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSV 82
            ||.||   ..:.:.|  .|...|.::  |.|..||:.||.:|..|  ||.:|:..|..||||..:
 Frog    71 DRFGF---LHKEELPIHDEVAQKQKLLEIERTTKWVKMIKSWDKY--KNSEKLHRRIYKGIPLQL 130

  Fly    83 RPKAWFYLSGAYLLKKKNPNVYNELLEKPGN-PTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELF 146
            |.:.|..:.....||::..::|..|.:|... ...|.:|..|.:|.|..|.||.:...|.|..||
 Frog   131 RGEVWSLILEVSKLKEERKDLYLVLKQKARRLSADIRQIDLDVNRTFRDHIMFRERYGVKQQALF 195

  Fly   147 NVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCD---VYLQDYFIPGLEVIQNDA 208
            :||.|||:||.:||:||..:.|.|.|||::..|||||..|.:..   ..:..:|:||...:....
 Frog   196 HVLAAYSLYNTEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHGFFVPGFPKLLRFQ 260

  Fly   209 GILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFL-CAMTRTLPWETLLRVWDCFLAEGIRVIFKV 272
            ...:.:|||..|.:.:|.:..::...||...||. |.:.|| |:...||:||.::.||.|::..:
 Frog   261 EHHDRILKKFMPKLKQHFETQELYTSLYTMKWFFQCFLDRT-PFTLNLRIWDIYILEGERILTAM 324

  Fly   273 ALVIIGASLSRHK---VRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQ 334
            :..|    |..||   ::::...|.|.|....:.:.| .:::::|:            |:..:..
 Frog   325 SYAI----LKLHKRTLIKQSLEDLIEFLQEELARDFH-YDDDYVID------------QLSLSMT 372

  Fly   335 KARRAK 340
            :.||||
 Frog   373 ELRRAK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/166 (34%)
usp6nlXP_031754908.1 TBC 122..337 CDD:214540 72/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.