DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d9b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001107313.1 Gene:tbc1d9b / 100135104 XenbaseID:XB-GENE-989754 Length:1259 Species:Xenopus tropicalis


Alignment Length:334 Identity:92/334 - (27%)
Similarity:161/334 - (48%) Gaps:39/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATAPRSLDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIARE------KKW---LYMID 57
            ||.|....:..:..|.|: |..||       :|.|.......::..||      .||   ....:
 Frog   423 ATNPSPSSSTDVSPTFST-PQNNG-------SDAPTASHGLLKLFQREITEDMKPKWDKEKMKEE 479

  Fly    58 NWSIYMSK--------NYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNP 114
            :|:|:..:        ...|.|:...||||:::|.:.|...|||......:|..|.:|:||....
 Frog   480 SWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWLLFSGASNEMVTHPGYYADLVEKSMGR 544

  Fly   115 TTI--EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLP 177
            ..:  :||::|.||..|.|..|.:|  :|...|..||.||:..||.:|:|||...:.:.||::..
 Frog   545 CNLATDEIERDLHRSMPEHPAFQNE--LGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYCN 607

  Fly   178 AEDAFWVFVSVCDVYLQDYF---IPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTD 239
            .|:|||:.||:|:..|.||:   :.|..|   |.|:.|.|.:...|.:...:|:..|...:.:: 
 Frog   608 EEEAFWLLVSLCEHMLPDYYNTRVVGALV---DQGVFEELTRLYLPQLSEKMQELGVISTISLS- 668

  Fly   240 WFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPE 304
            |||......:|:|:.:.|.|||..|||::|.:::|.::.|::   :....|....|.:.:|....
 Frog   669 WFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVLEANM---ESLMNCMDEGEAMTILGRYL 730

  Fly   305 EHIVEEEFI 313
            ::::.::.:
 Frog   731 DNVLNKQSV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 56/167 (34%)
tbc1d9bNP_001107313.1 PH-GRAM1_TCB1D9_TCB1D9B 154..251 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 299..394 CDD:270161
TBC 504..714 CDD:214540 71/218 (33%)
EFh <854..905 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.