DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d8b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001107709.2 Gene:tbc1d8b / 100101803 XenbaseID:XB-GENE-923435 Length:1119 Species:Xenopus tropicalis


Alignment Length:276 Identity:84/276 - (30%)
Similarity:132/276 - (47%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WSIYMSK--------NYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPT 115
            |.|..::        ..||.|:...:|||:::|.:.|...|||......||..|.|::||.....
 Frog   456 WKILFTECGRGVSMFRTKKTRNLVVRGIPETLRGELWLLFSGAVNDMAANPGYYTEIVEKSLGTC 520

  Fly   116 TI--EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPA 178
            |:  :||::|..|..|.|..|  :...|...|..||.||:..|||:|:|||...:.:.||::...
 Frog   521 TLATDEIERDLRRSLPEHPAF--QSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKE 583

  Fly   179 EDAFWVFVSVCDVYLQDYF---IPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTD- 239
            |:|||:.|:||:..|.|||   |.|..|   |..:.|.|:|:..|.:..|           ||| 
 Frog   584 EEAFWLLVAVCERMLPDYFNRRIIGALV---DQAVFEELIKEYLPLLTSH-----------MTDI 634

  Fly   240 ---------WFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCE 295
                     |||......||.|:.:.|.|||..:||:.|.::.||::..::.:   ...|....|
 Frog   635 TFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLVVLDFNMEK---LLACKDDAE 696

  Fly   296 TLAVLRSPEEHIVEEE 311
            .:.:|....:::|.::
 Frog   697 AVTILNRFFDNVVNKD 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 61/177 (34%)
tbc1d8bNP_001107709.2 PH-GRAM1_TBC1D8B 155..253 CDD:275419
PH-GRAM2_TBC1D8B 295..387 CDD:270159
TBC 481..689 CDD:214540 75/226 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.