DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARK1 and KP78b

DIOPT Version :9

Sequence 1:NP_001273053.1 Gene:MARK1 / 4139 HGNCID:6896 Length:796 Species:Homo sapiens
Sequence 2:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster


Alignment Length:693 Identity:281/693 - (40%)
Similarity:384/693 - (55%) Gaps:127/693 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     2 SARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSI--TSATDEQPHI-----GN 59
            :|.|...|..|.|...:||:.....|     .|::.||:..|..|.  .|:...|.::     |.
  Fly     3 AANTNKTTDKENDPGPNTSISTTATP-----PSAAAQNVGGCFGSSGGRSSPKFQSYVNGNGYGV 62

Human    60 YRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE 124
            |::.||:|||||||||||.|:.||||||:|:||||.||..:.|||:|||.|||.|||||||:|.:
  Fly    63 YKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNTIARQKLYREVNIMKKLNHPNIVRLLQ 127

Human   125 VIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLL 189
            |||:|:||||||||.||||:|:|||.:|||:|::||..|||:|||::|||.|.||||||||||||
  Fly   128 VIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLL 192

Human   190 LDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGS 254
            ||..|.:||||||||..|.....|:||||||||||||||:||||.|||||.|||||:||||||||
  Fly   193 LDQQMKLKIADFGFSTTFEPKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTLVSGS 257

Human   255 LPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEE-E 318
            |||||.||||||:||||||||:|:|:|.:||:|::|.|||||.:|.||..:|.|||:|:|:|: .
  Fly   258 LPFDGTNLKELRDRVLRGKYRVPYYVSIECESLIRKFLVLNPTQRTSLSAVMADRWINMGYEQGN 322

Human   319 ELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPPEFEGGESLSS 383
            .|:|:.|...|.:|..|:.::..||....::..:|.|||:|::..||:||....|          
  Fly   323 GLRPFQEKPMDLHDVNRLSLLSNMGHKPRDVEQSLKNQKFDDIYCTYMLLDVAKP---------- 377

Human   384 GNLCQRSRPSSDLNNSTLQS-----PAHLKVQRSISANQ---KQRRFS-DHAGPSIPPAVSYTKR 439
                 ||...|:.:.|:.:.     |...::...|:|..   .|..|: |.:.|:         |
  Fly   378 -----RSTACSEKSGSSFRETPTAMPGSSRIPVPIAAPNVTISQVTFALDKSTPN---------R 428

Human   440 PQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPSNNVYSGGSMARRNT 504
            |.|.|:         :.:|.:|.:.       :|..||..|.:|                     
  Fly   429 PAATSI---------RPMAPRLANA-------LTPLPLTPPPKK--------------------- 456

Human   505 YVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVP-SARPRHQKSMSTSGHPIKVTLPT 568
            |:|                    .|.|..::...|..|::| ||.|:  |.:   |.|:.|....
  Fly   457 YIC--------------------CSASKAANPRRSEPSSIPQSAMPK--KGV---GSPVDVKTTL 496

Human   569 IKDGSEAYRPGSTTQRVPAASPSAHSISTATPDR----TRFPRGSSSRSTFHGEQLRERRSVAYN 629
            :    .|.|..:..|::.:||....|..|.:|.:    ||.|.............|:..:.||.|
  Fly   497 L----SAQRKLAVNQKLTSASHQIRSPITQSPSQASECTRTPPTHFEMLDSTSTPLKVLKLVASN 557

Human   630 G--PPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGE 670
            .  ||::        .:..|.|..|..||::::||||...:||
  Fly   558 SQTPPST--------ENTNRPTRVGFFSKLSARFVRRSLHKGE 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARK1NP_001273053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 10/37 (27%)
STKc_MARK 59..311 CDD:270974 179/251 (71%)
S_TKc 60..311 CDD:214567 179/250 (72%)
UBA_MARK1 331..371 CDD:270588 13/39 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..495 22/126 (17%)
MARK1-3_C 697..794 CDD:213381
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 179/250 (72%)
S_TKc 63..314 CDD:214567 179/250 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.